Lineage for d1x3aa1 (1x3a A:8-94)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780794Fold a.240: BSD domain-like [140382] (1 superfamily)
    core: 3 helices; triangular array; the extra N-terminal and C-terminal helices form a coiled coil structure
  4. 780795Superfamily a.240.1: BSD domain-like [140383] (1 family) (S)
  5. 780796Family a.240.1.1: BSD domain [140384] (2 proteins)
    Pfam PF03909
  6. 780797Protein Synapse associated protein 1, SYAP1 [140387] (1 species)
  7. 780798Species Human (Homo sapiens) [TaxId:9606] [140388] (1 PDB entry)
    Uniprot Q96A49 130-216
  8. 780799Domain d1x3aa1: 1x3a A:8-94 [121659]

Details for d1x3aa1

PDB Entry: 1x3a (more details)

PDB Description: Solution structure of the BSD domain of human Synapse associated protein 1
PDB Compounds: (A:) Synapse associated protein 1

SCOP Domain Sequences for d1x3aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3aa1 a.240.1.1 (A:8-94) Synapse associated protein 1, SYAP1 {Human (Homo sapiens) [TaxId: 9606]}
tndeetiqqqilalsadkrnflrdppagvqfnfdfdqmypvalvmlqedellskmrfalv
pklvkeevfwrnyfyrvslikqsaqlt

SCOP Domain Coordinates for d1x3aa1:

Click to download the PDB-style file with coordinates for d1x3aa1.
(The format of our PDB-style files is described here.)

Timeline for d1x3aa1: