![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.240: BSD domain-like [140382] (1 superfamily) core: 3 helices; triangular array; the extra N-terminal and C-terminal helices form a coiled coil structure |
![]() | Superfamily a.240.1: BSD domain-like [140383] (1 family) ![]() |
![]() | Family a.240.1.1: BSD domain [140384] (2 proteins) Pfam PF03909 |
![]() | Protein Synapse associated protein 1, SYAP1 [140387] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140388] (1 PDB entry) |
![]() | Domain d1x3aa1: 1x3a A:8-94 [121659] |
PDB Entry: 1x3a (more details)
SCOP Domain Sequences for d1x3aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3aa1 a.240.1.1 (A:8-94) Synapse associated protein 1, SYAP1 {Human (Homo sapiens) [TaxId: 9606]} tndeetiqqqilalsadkrnflrdppagvqfnfdfdqmypvalvmlqedellskmrfalv pklvkeevfwrnyfyrvslikqsaqlt
Timeline for d1x3aa1: