Lineage for d1x3aa1 (1x3a A:8-94)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015902Fold a.240: BSD domain-like [140382] (1 superfamily)
    core: 3 helices; triangular array; the extra N-terminal and C-terminal helices form a coiled coil structure
  4. 2015903Superfamily a.240.1: BSD domain-like [140383] (1 family) (S)
  5. 2015904Family a.240.1.1: BSD domain [140384] (2 protein domains)
    Pfam PF03909
  6. 2015905Protein Synapse associated protein 1, SYAP1 [140387] (1 species)
  7. 2015906Species Human (Homo sapiens) [TaxId:9606] [140388] (1 PDB entry)
    Uniprot Q96A49 130-216
  8. 2015907Domain d1x3aa1: 1x3a A:8-94 [121659]
    Other proteins in same PDB: d1x3aa2, d1x3aa3

Details for d1x3aa1

PDB Entry: 1x3a (more details)

PDB Description: Solution structure of the BSD domain of human Synapse associated protein 1
PDB Compounds: (A:) Synapse associated protein 1

SCOPe Domain Sequences for d1x3aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3aa1 a.240.1.1 (A:8-94) Synapse associated protein 1, SYAP1 {Human (Homo sapiens) [TaxId: 9606]}
tndeetiqqqilalsadkrnflrdppagvqfnfdfdqmypvalvmlqedellskmrfalv
pklvkeevfwrnyfyrvslikqsaqlt

SCOPe Domain Coordinates for d1x3aa1:

Click to download the PDB-style file with coordinates for d1x3aa1.
(The format of our PDB-style files is described here.)

Timeline for d1x3aa1: