SCOPe 2.08: Domain d1x39a2: 1x39 A:389-602

Lineage for d1x39a2 (1x39 A:389-602)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families)
   automatically mapped to Pfam PF01915

5. Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain-like [52280] (3 proteins)

6. Protein Beta-D-glucan exohydrolase, C-terminal domain [52281] (2 species)
   interdomain linker forms an additional, N-terminal strand

7. Species Barley (Hordeum vulgare) [TaxId:4513] [52282] (9 PDB entries)

8. Domain d1x39a2: 1x39 A:389-602 [121658]
   Other proteins in same PDB: d1x39a1
   automated match to d1lq2a2
   complexed with gol, ide, so4

Details for d1x39a2

PDB Entry: 1x39, 1.8 Å

PDB Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole

PDB Compounds: (A:) beta-D-glucan exohydrolase isoenzyme ExoI

SCOPe Domain Sequences for d1x39a2:

Sequence; same for both SEQRES and ATOM records:

>d1x39a2 c.23.11.1 (A:389-602) Beta-D-glucan exohydrolase, C-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat

Timeline for d1x39a2:

• d1x39a2 first appeared in SCOP 1.73
  
• d1x39a2 appears in SCOPe 2.07