SCOP 1.73: Domain d1x32a1: 1x32 A:3-47

Lineage for d1x32a1 (1x32 A:3-47)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (7 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein CpSRP43 [141216] (1 species)
   Signal recognition particle 43 kDa protein, chloroplast precursor (CAO)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141217] (3 PDB entries)

8. Domain d1x32a1: 1x32 A:3-47 [121654]

Details for d1x32a1

PDB Entry: 1x32

PDB Description: three dimensional solution structure of the chromo1 domain of cpsrp43

PDB Compounds: (A:) chloroplast signal recognition particle component

SCOP Domain Sequences for d1x32a1:

Sequence; same for both SEQRES and ATOM records:

>d1x32a1 b.34.13.2 (A:3-47) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gevnkiigsrtagegameyliewkdghspswvpssyiaadvvsey

Timeline for d1x32a1:

• d1x32a1 is new in SCOP 1.73
  
• d1x32a1 appears in SCOP 1.75
  
• d1x32a1 appears in the current release, SCOPe 2.08