Lineage for d1x32a1 (1x32 A:3-47)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665974Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 665998Family b.34.13.2: Chromo domain [54165] (7 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 666035Protein CpSRP43 [141216] (1 species)
    Signal recognition particle 43 kDa protein, chloroplast precursor (CAO)
  7. 666036Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141217] (3 PDB entries)
  8. 666038Domain d1x32a1: 1x32 A:3-47 [121654]

Details for d1x32a1

PDB Entry: 1x32 (more details)

PDB Description: Three Dimensional Solution Structure of the Chromo1 domain of cpSRP43
PDB Compounds: (A:) chloroplast signal recognition particle component

SCOP Domain Sequences for d1x32a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x32a1 b.34.13.2 (A:3-47) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gevnkiigsrtagegameyliewkdghspswvpssyiaadvvsey

SCOP Domain Coordinates for d1x32a1:

Click to download the PDB-style file with coordinates for d1x32a1.
(The format of our PDB-style files is described here.)

Timeline for d1x32a1: