SCOP 1.73: Domain d1x2wb1: 1x2w B:1-123

Lineage for d1x2wb1 (1x2w B:1-123)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin beta chain [88867] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (6 PDB entries)

8. Domain d1x2wb1: 1x2w B:1-123 [121653]
   Other proteins in same PDB: d1x2wa1
   automatically matched to d1bj3b_
   complexed with cl, rb, so4

Details for d1x2wb1

PDB Entry: 1x2w, 2.29 Å

PDB Description: crystal structure of apo-habu ix-bp at ph 4.6

PDB Compounds: (B:) Coagulation factor IX/factor X-binding protein B chain

SCOP Domain Sequences for d1x2wb1:

Sequence; same for both SEQRES and ATOM records:

>d1x2wb1 d.169.1.1 (B:1-123) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

Timeline for d1x2wb1:

• d1x2wb1 appears in SCOP 1.75
  
• d1x2wb1 appears in the current release, SCOPe 2.07, called d1x2wb_