Lineage for d1x2wb_ (1x2w B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001710Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 3001711Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (6 PDB entries)
  8. 3001719Domain d1x2wb_: 1x2w B: [121653]
    Other proteins in same PDB: d1x2wa_
    automated match to d1bj3b_
    complexed with cl, rb, so4

Details for d1x2wb_

PDB Entry: 1x2w (more details), 2.29 Å

PDB Description: crystal structure of apo-habu ix-bp at ph 4.6
PDB Compounds: (B:) Coagulation factor IX/factor X-binding protein B chain

SCOPe Domain Sequences for d1x2wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2wb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

SCOPe Domain Coordinates for d1x2wb_:

Click to download the PDB-style file with coordinates for d1x2wb_.
(The format of our PDB-style files is described here.)

Timeline for d1x2wb_: