Lineage for d1x2td1 (1x2t D:1-123)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738201Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 738202Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (6 PDB entries)
  8. 738205Domain d1x2td1: 1x2t D:1-123 [121651]
    Other proteins in same PDB: d1x2ta1, d1x2tc1
    automatically matched to d1bj3b_
    complexed with 1pe, ca

Details for d1x2td1

PDB Entry: 1x2t (more details), 1.72 Å

PDB Description: crystal structure of habu ix-bp at ph 6.5
PDB Compounds: (D:) Coagulation factor IX/factor X-binding protein B chain

SCOP Domain Sequences for d1x2td1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2td1 d.169.1.1 (D:1-123) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

SCOP Domain Coordinates for d1x2td1:

Click to download the PDB-style file with coordinates for d1x2td1.
(The format of our PDB-style files is described here.)

Timeline for d1x2td1: