SCOP 1.73: Domain d1x2tc1: 1x2t C:1-129

Lineage for d1x2tc1 (1x2t C:1-129)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin alpha chain [88861] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88862] (6 PDB entries)

8. Domain d1x2tc1: 1x2t C:1-129 [121650]
   Other proteins in same PDB: d1x2tb1, d1x2td1
   automatically matched to d1bj3a_
   complexed with 1pe, ca

Details for d1x2tc1

PDB Entry: 1x2t, 1.72 Å

PDB Description: crystal structure of habu ix-bp at ph 6.5

PDB Compounds: (C:) Coagulation factor IX/X-binding protein A chain

SCOP Domain Sequences for d1x2tc1:

Sequence; same for both SEQRES and ATOM records:

>d1x2tc1 d.169.1.1 (C:1-129) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
qqnpfvcea

Timeline for d1x2tc1:

• d1x2tc1 is new in SCOP 1.73
  
• d1x2tc1 appears in SCOP 1.75
  
• d1x2tc1 appears in the current release, SCOPe 2.08, called d1x2tc_