Lineage for d1x2tb_ (1x2t B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2234986Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 2234987Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (6 PDB entries)
  8. 2234989Domain d1x2tb_: 1x2t B: [121649]
    Other proteins in same PDB: d1x2ta_, d1x2tc_
    automated match to d1bj3b_
    complexed with 1pe, ca

Details for d1x2tb_

PDB Entry: 1x2t (more details), 1.72 Å

PDB Description: crystal structure of habu ix-bp at ph 6.5
PDB Compounds: (B:) Coagulation factor IX/factor X-binding protein B chain

SCOPe Domain Sequences for d1x2tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2tb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

SCOPe Domain Coordinates for d1x2tb_:

Click to download the PDB-style file with coordinates for d1x2tb_.
(The format of our PDB-style files is described here.)

Timeline for d1x2tb_: