Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Homeobox protein pknox1 [140153] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140154] (1 PDB entry) Uniprot P55347 257-318 |
Domain d1x2na1: 1x2n A:8-67 [121646] Other proteins in same PDB: d1x2na2, d1x2na3 |
PDB Entry: 1x2n (more details)
SCOPe Domain Sequences for d1x2na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2na1 a.4.1.1 (A:8-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} knkrgvlpkhatnvmrswlfqhighpyptedekkqiaaqtnltllqvnnwfinarrrilq
Timeline for d1x2na1: