Lineage for d1x2na1 (1x2n A:6-67)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761141Family a.4.1.1: Homeodomain [46690] (40 proteins)
    Pfam PF00046
  6. 761210Protein Homeobox protein pknox1 [140153] (1 species)
  7. 761211Species Human (Homo sapiens) [TaxId:9606] [140154] (1 PDB entry)
    Uniprot P55347 257-318
  8. 761212Domain d1x2na1: 1x2n A:6-67 [121646]

Details for d1x2na1

PDB Entry: 1x2n (more details)

PDB Description: Solution structure of the homeobox domain of human homeobox protein PKNOX1
PDB Compounds: (A:) Homeobox protein PKNOX1

SCOP Domain Sequences for d1x2na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]}
sgknkrgvlpkhatnvmrswlfqhighpyptedekkqiaaqtnltllqvnnwfinarrri
lq

SCOP Domain Coordinates for d1x2na1:

Click to download the PDB-style file with coordinates for d1x2na1.
(The format of our PDB-style files is described here.)

Timeline for d1x2na1: