Lineage for d1x2na1 (1x2n A:8-67)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691850Protein Homeobox protein pknox1 [140153] (1 species)
  7. 2691851Species Human (Homo sapiens) [TaxId:9606] [140154] (1 PDB entry)
    Uniprot P55347 257-318
  8. 2691852Domain d1x2na1: 1x2n A:8-67 [121646]
    Other proteins in same PDB: d1x2na2, d1x2na3

Details for d1x2na1

PDB Entry: 1x2n (more details)

PDB Description: solution structure of the homeobox domain of human homeobox protein pknox1
PDB Compounds: (A:) Homeobox protein PKNOX1

SCOPe Domain Sequences for d1x2na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2na1 a.4.1.1 (A:8-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]}
knkrgvlpkhatnvmrswlfqhighpyptedekkqiaaqtnltllqvnnwfinarrrilq

SCOPe Domain Coordinates for d1x2na1:

Click to download the PDB-style file with coordinates for d1x2na1.
(The format of our PDB-style files is described here.)

Timeline for d1x2na1: