![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (19 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (40 proteins) Pfam PF00046 |
![]() | Protein Lag1 longevity assurance homolog 6, LASS6 [140147] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140148] (1 PDB entry) Uniprot Q8C172 76-127 |
![]() | Domain d1x2ma1: 1x2m A:8-59 [121645] |
PDB Entry: 1x2m (more details)
SCOP Domain Sequences for d1x2ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} taqpnailekvftaitkhpdekrleglskqldwdvrsiqrwfrqrrnqekps
Timeline for d1x2ma1: