![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.11: Kelch motif [117281] (1 family) ![]() |
![]() | Family b.68.11.1: Kelch motif [117282] (1 protein) Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (scop_pr 50967) |
![]() | Protein Kelch-like ECH-associated protein 1, KEAP1 [117283] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [141550] (2 PDB entries) |
![]() | Domain d1x2ja1: 1x2j A:324-613 [121643] complexed with so4; mutant |
PDB Entry: 1x2j (more details), 1.6 Å
SCOP Domain Sequences for d1x2ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2ja1 b.68.11.1 (A:324-613) Kelch-like ECH-associated protein 1, KEAP1 {Mouse (Mus musculus) [TaxId: 10090]} vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc
Timeline for d1x2ja1: