![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
![]() | Family a.60.2.5: Hef domain-like [140629] (4 proteins) helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft) |
![]() | Protein ATP-dependent RNA helicase PF2015 [140632] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [140633] (1 PDB entry) Uniprot Q8TZH8 694-761 |
![]() | Domain d1x2ib_: 1x2i B: [121642] automated match to d1x2ia1 |
PDB Entry: 1x2i (more details), 1.45 Å
SCOPe Domain Sequences for d1x2ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2ib_ a.60.2.5 (B:) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} altlaerqrliveglphvsatlarrllkhfgsvervftasvaelmkvegigekiakeirr vitapyie
Timeline for d1x2ib_: