SCOPe 2.05: Domain d1x2ia1: 1x2i A:2-69

Lineage for d1x2ia1 (1x2i A:2-69)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.5: Hef domain-like [140629] (4 proteins)
   helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)

6. Protein ATP-dependent RNA helicase PF2015 [140632] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [140633] (1 PDB entry)
   Uniprot Q8TZH8 694-761

8. Domain d1x2ia1: 1x2i A:2-69 [121641]

Details for d1x2ia1

PDB Entry: 1x2i, 1.45 Å

PDB Description: Crystal Structure Of Archaeal Xpf/Mus81 Homolog, Hef From Pyrococcus Furiosus, Helix-hairpin-helix Domain

PDB Compounds: (A:) Hef helicase/nuclease

SCOPe Domain Sequences for d1x2ia1:

Sequence; same for both SEQRES and ATOM records:

>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}
altlaerqrliveglphvsatlarrllkhfgsvervftasvaelmkvegigekiakeirr
vitapyie

Timeline for d1x2ia1:

• d1x2ia1 first appeared in SCOP 1.73
  
• d1x2ia1 appears in SCOPe 2.04
  
• d1x2ia1 appears in SCOPe 2.06
  
• d1x2ia1 appears in the current release, SCOPe 2.08