Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) duplication: contains two helix-hairpin-helix (HhH) motifs |
Family a.60.2.5: Hef domain-like [140629] (4 proteins) helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft) |
Protein ATP-dependent RNA helicase PF2015 [140632] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [140633] (1 PDB entry) Uniprot Q8TZH8 694-761 |
Domain d1x2ia1: 1x2i A:2-69 [121641] |
PDB Entry: 1x2i (more details), 1.45 Å
SCOPe Domain Sequences for d1x2ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} altlaerqrliveglphvsatlarrllkhfgsvervftasvaelmkvegigekiakeirr vitapyie
Timeline for d1x2ia1: