SCOPe 2.08: Domain d1x2ea_: 1x2e A:

Lineage for d1x2ea_ (1x2e A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins)

6. Protein automated matches [190125] (1 species)
   not a true protein

7. Species Serratia marcescens [TaxId:615] [186849] (2 PDB entries)

8. Domain d1x2ea_: 1x2e A: [121640]
   automated match to d1qtra_
   complexed with atx

Details for d1x2ea_

PDB Entry: 1x2e, 2.4 Å

PDB Description: The crystal structure of prolyl aminopeptidase complexed with Ala-TBODA

PDB Compounds: (A:) proline iminopeptidase

SCOPe Domain Sequences for d1x2ea_:

Sequence; same for both SEQRES and ATOM records:

>d1x2ea_ c.69.1.7 (A:) automated matches {Serratia marcescens [TaxId: 615]}
lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper
ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya
qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq
rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle
sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi
lhqlmiatdrfag

Timeline for d1x2ea_:

• d1x2ea_ first appeared in SCOP 1.73, called d1x2ea1
  
• d1x2ea_ appears in SCOPe 2.07