![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins) |
![]() | Protein automated matches [190125] (1 species) not a true protein |
![]() | Species Serratia marcescens [TaxId:615] [186849] (2 PDB entries) |
![]() | Domain d1x2ea_: 1x2e A: [121640] automated match to d1qtra_ complexed with atx |
PDB Entry: 1x2e (more details), 2.4 Å
SCOPe Domain Sequences for d1x2ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2ea_ c.69.1.7 (A:) automated matches {Serratia marcescens [TaxId: 615]} lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi lhqlmiatdrfag
Timeline for d1x2ea_: