Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.7: Proline iminopeptidase-like [53509] (3 proteins) |
Protein Proline aminopeptidase [81303] (1 species) |
Species Serratia marcescens [TaxId:615] [81304] (4 PDB entries) |
Domain d1x2ba1: 1x2b A:4-316 [121639] automatically matched to d1qtra_ complexed with stx |
PDB Entry: 1x2b (more details), 2.4 Å
SCOP Domain Sequences for d1x2ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2ba1 c.69.1.7 (A:4-316) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi lhqlmiatdrfag
Timeline for d1x2ba1: