SCOP 1.73: Domain d1x2ba1: 1x2b A:4-316

Lineage for d1x2ba1 (1x2b A:4-316)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.7: Proline iminopeptidase-like [53509] (3 proteins)

6. Protein Proline aminopeptidase [81303] (1 species)

7. Species Serratia marcescens [TaxId:615] [81304] (4 PDB entries)

8. Domain d1x2ba1: 1x2b A:4-316 [121639]
   automatically matched to d1qtra_
   complexed with stx

Details for d1x2ba1

PDB Entry: 1x2b, 2.4 Å

PDB Description: The crystal structure of prolyl aminopeptidase complexed with Sar-TBODA

PDB Compounds: (A:) proline iminopeptidase

SCOP Domain Sequences for d1x2ba1:

Sequence; same for both SEQRES and ATOM records:

>d1x2ba1 c.69.1.7 (A:4-316) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}
lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper
ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya
qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq
rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle
sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi
lhqlmiatdrfag

Timeline for d1x2ba1:

• d1x2ba1 is new in SCOP 1.73
  
• d1x2ba1 appears in SCOP 1.75
  
• d1x2ba1 appears in the current release, SCOPe 2.08, called d1x2ba_