Lineage for d1x29a1 (1x29 A:5-409)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 705387Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 705422Species Escherichia coli [TaxId:562] [53390] (60 PDB entries)
  8. 705436Domain d1x29a1: 1x29 A:5-409 [121635]
    automatically matched to d1aaw__
    complexed with pmg

Details for d1x29a1

PDB Entry: 1x29 (more details), 2.2 Å

PDB Description: crystal structure of e.coli aspat complexed with n-phosphopyridoxyl-2- methyl-l-glutamic acid
PDB Compounds: (A:) aspartate aminotransferase

SCOP Domain Sequences for d1x29a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x29a1 c.67.1.1 (A:5-409) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOP Domain Coordinates for d1x29a1:

Click to download the PDB-style file with coordinates for d1x29a1.
(The format of our PDB-style files is described here.)

Timeline for d1x29a1: