Lineage for d1x27f1 (1x27 F:64-118)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783698Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species)
  7. 1783699Species Human (Homo sapiens) [TaxId:9606] [50077] (5 PDB entries)
  8. 1783707Domain d1x27f1: 1x27 F:64-118 [121631]
    Other proteins in same PDB: d1x27a2, d1x27b2, d1x27c2, d1x27d2, d1x27e2, d1x27f2
    automatically matched to d1h92a_
    complexed with na

Details for d1x27f1

PDB Entry: 1x27 (more details), 2.7 Å

PDB Description: Crystal Structure of Lck SH2-SH3 with SH2 binding site of p130Cas
PDB Compounds: (F:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d1x27f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x27f1 b.34.2.1 (F:64-118) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvak

SCOPe Domain Coordinates for d1x27f1:

Click to download the PDB-style file with coordinates for d1x27f1.
(The format of our PDB-style files is described here.)

Timeline for d1x27f1: