![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50077] (5 PDB entries) |
![]() | Domain d1x27e1: 1x27 E:64-118 [121629] Other proteins in same PDB: d1x27a2, d1x27b2, d1x27b3, d1x27c2, d1x27c3, d1x27d2, d1x27e2, d1x27f2 automatically matched to d1h92a_ complexed with na |
PDB Entry: 1x27 (more details), 2.7 Å
SCOPe Domain Sequences for d1x27e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x27e1 b.34.2.1 (E:64-118) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvak
Timeline for d1x27e1: