Lineage for d1x27c1 (1x27 C:64-118)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665103Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 665104Family b.34.2.1: SH3-domain [50045] (38 proteins)
  6. 665328Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species)
  7. 665329Species Human (Homo sapiens) [TaxId:9606] [50077] (5 PDB entries)
  8. 665334Domain d1x27c1: 1x27 C:64-118 [121625]
    Other proteins in same PDB: d1x27a2, d1x27b2, d1x27c2, d1x27d2, d1x27e2, d1x27f2
    automatically matched to d1h92a_
    complexed with na

Details for d1x27c1

PDB Entry: 1x27 (more details), 2.7 Å

PDB Description: Crystal Structure of Lck SH2-SH3 with SH2 binding site of p130Cas
PDB Compounds: (C:) Proto-oncogene tyrosine-protein kinase LCK

SCOP Domain Sequences for d1x27c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x27c1 b.34.2.1 (C:64-118) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvak

SCOP Domain Coordinates for d1x27c1:

Click to download the PDB-style file with coordinates for d1x27c1.
(The format of our PDB-style files is described here.)

Timeline for d1x27c1: