Lineage for d1x27b2 (1x27 B:119-226)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206751Protein p56-lck tyrosine kinase [55552] (1 species)
  7. 2206752Species Human (Homo sapiens) [TaxId:9606] [55553] (11 PDB entries)
  8. 2206767Domain d1x27b2: 1x27 B:119-226 [121624]
    Other proteins in same PDB: d1x27a1, d1x27b1, d1x27b3, d1x27c1, d1x27c3, d1x27d1, d1x27e1, d1x27f1
    automatically matched to d1lcka2
    complexed with na

Details for d1x27b2

PDB Entry: 1x27 (more details), 2.7 Å

PDB Description: Crystal Structure of Lck SH2-SH3 with SH2 binding site of p130Cas
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d1x27b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x27b2 d.93.1.1 (B:119-226) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
anslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevv
khykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOPe Domain Coordinates for d1x27b2:

Click to download the PDB-style file with coordinates for d1x27b2.
(The format of our PDB-style files is described here.)

Timeline for d1x27b2: