![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (1 family) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (32 proteins) Pfam PF00017 |
![]() | Protein p56-lck tyrosine kinase [55552] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55553] (11 PDB entries) |
![]() | Domain d1x27a2: 1x27 A:119-226 [121622] Other proteins in same PDB: d1x27a1, d1x27b1, d1x27c1, d1x27d1, d1x27e1, d1x27f1 automatically matched to d1lcka2 complexed with na |
PDB Entry: 1x27 (more details), 2.7 Å
SCOP Domain Sequences for d1x27a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x27a2 d.93.1.1 (A:119-226) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} anslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevv khykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
Timeline for d1x27a2: