Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (2 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.1: YjgF/L-PSP [55299] (10 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
Protein Hypothetical protein ST0811 [143521] (1 species) |
Species Sulfolobus tokodaii [TaxId:111955] [143522] (1 PDB entry) |
Domain d1x25b1: 1x25 B:1-124 [121620] automatically matched to 1X25 A:1-124 |
PDB Entry: 1x25 (more details), 2 Å
SCOP Domain Sequences for d1x25b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x25b1 d.79.1.1 (B:1-124) Hypothetical protein ST0811 {Sulfolobus tokodaii [TaxId: 111955]} metvftekapkpvgpysqaikvgntlyvsgqipidprtneivkgdikvqtrqvldnikei vkaagfslsdvamafvflkdmnmfndfnsvyaeyfkdkpparvtvevsrlpkdalieiav icsk
Timeline for d1x25b1: