SCOP 1.73: Domain d1x25b1: 1x25 B:1-124

Lineage for d1x25b1 (1x25 B:1-124)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (2 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (10 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein Hypothetical protein ST0811 [143521] (1 species)

7. Species Sulfolobus tokodaii [TaxId:111955] [143522] (1 PDB entry)

8. Domain d1x25b1: 1x25 B:1-124 [121620]
   automatically matched to 1X25 A:1-124

Details for d1x25b1

PDB Entry: 1x25, 2 Å

PDB Description: Crystal Structure of a Member of YjgF Family from Sulfolobus Tokodaii (ST0811)

PDB Compounds: (B:) Hypothetical UPF0076 protein ST0811

SCOP Domain Sequences for d1x25b1:

Sequence; same for both SEQRES and ATOM records:

>d1x25b1 d.79.1.1 (B:1-124) Hypothetical protein ST0811 {Sulfolobus tokodaii [TaxId: 111955]}
metvftekapkpvgpysqaikvgntlyvsgqipidprtneivkgdikvqtrqvldnikei
vkaagfslsdvamafvflkdmnmfndfnsvyaeyfkdkpparvtvevsrlpkdalieiav
icsk

Timeline for d1x25b1:

• d1x25b1 is new in SCOP 1.73
  
• d1x25b1 appears in SCOP 1.75
  
• d1x25b1 appears in the current release, SCOPe 2.08, called d1x25b2