SCOPe 2.08: Domain d1x25b2: 1x25 B:1-125

Lineage for d1x25b2 (1x25 B:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (4 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein Hypothetical protein ST0811 [143521] (1 species)

7. Species Sulfolobus tokodaii [TaxId:111955] [143522] (1 PDB entry)
   Uniprot Q973T6 1-124

8. Domain d1x25b2: 1x25 B:1-125 [121620]
   Other proteins in same PDB: d1x25a2, d1x25b3
   automated match to d1x25a1

Details for d1x25b2

PDB Entry: 1x25, 2 Å

PDB Description: Crystal Structure of a Member of YjgF Family from Sulfolobus Tokodaii (ST0811)

PDB Compounds: (B:) Hypothetical UPF0076 protein ST0811

SCOPe Domain Sequences for d1x25b2:

Sequence; same for both SEQRES and ATOM records:

>d1x25b2 d.79.1.1 (B:1-125) Hypothetical protein ST0811 {Sulfolobus tokodaii [TaxId: 111955]}
metvftekapkpvgpysqaikvgntlyvsgqipidprtneivkgdikvqtrqvldnikei
vkaagfslsdvamafvflkdmnmfndfnsvyaeyfkdkpparvtvevsrlpkdalieiav
icskg

Timeline for d1x25b2:

• d1x25b2 first appeared in SCOP 1.73, called d1x25b1
  
• d1x25b2 appears in SCOPe 2.07