Lineage for d1x25a1 (1x25 A:1-124)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958678Protein Hypothetical protein ST0811 [143521] (1 species)
  7. 2958679Species Sulfolobus tokodaii [TaxId:111955] [143522] (1 PDB entry)
    Uniprot Q973T6 1-124
  8. 2958680Domain d1x25a1: 1x25 A:1-124 [121619]
    Other proteins in same PDB: d1x25a2, d1x25b3

Details for d1x25a1

PDB Entry: 1x25 (more details), 2 Å

PDB Description: Crystal Structure of a Member of YjgF Family from Sulfolobus Tokodaii (ST0811)
PDB Compounds: (A:) Hypothetical UPF0076 protein ST0811

SCOPe Domain Sequences for d1x25a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x25a1 d.79.1.1 (A:1-124) Hypothetical protein ST0811 {Sulfolobus tokodaii [TaxId: 111955]}
metvftekapkpvgpysqaikvgntlyvsgqipidprtneivkgdikvqtrqvldnikei
vkaagfslsdvamafvflkdmnmfndfnsvyaeyfkdkpparvtvevsrlpkdalieiav
icsk

SCOPe Domain Coordinates for d1x25a1:

Click to download the PDB-style file with coordinates for d1x25a1.
(The format of our PDB-style files is described here.)

Timeline for d1x25a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x25a2