SCOPe 2.07: Domain d1x23d2: 1x23 D:1-147

Lineage for d1x23d2 (1x23 D:1-147)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)

8. Domain d1x23d2: 1x23 D:1-147 [121618]
   Other proteins in same PDB: d1x23a1, d1x23a2, d1x23b3, d1x23c3, d1x23d3
   automated match to d1ur6a_

Details for d1x23d2

PDB Entry: 1x23, 1.85 Å

PDB Description: Crystal structure of ubch5c

PDB Compounds: (D:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d1x23d2:

Sequence; same for both SEQRES and ATOM records:

>d1x23d2 d.20.1.1 (D:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrdkynrisrewtqkyam

Timeline for d1x23d2:

• d1x23d2 first appeared in SCOP 1.73, called d1x23d1
  
• d1x23d2 appears in SCOPe 2.06
  
• d1x23d2 appears in the current release, SCOPe 2.08