![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein automated matches [190124] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries) |
![]() | Domain d1x23d2: 1x23 D:1-147 [121618] Other proteins in same PDB: d1x23a1, d1x23a2, d1x23b3, d1x23c3, d1x23d3 automated match to d1ur6a_ |
PDB Entry: 1x23 (more details), 1.85 Å
SCOPe Domain Sequences for d1x23d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x23d2 d.20.1.1 (D:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]} malkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv peiariyktdrdkynrisrewtqkyam
Timeline for d1x23d2: