SCOP 1.73: Domain d1x23c1: 1x23 C:1-147

Lineage for d1x23c1 (1x23 C:1-147)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.1: UBC-related [54496] (6 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)

7. Species Human (Homo sapiens), E2 D3 [TaxId:9606] [143054] (2 PDB entries)

8. Domain d1x23c1: 1x23 C:1-147 [121617]
   automatically matched to 1X23 A:1-147

Details for d1x23c1

PDB Entry: 1x23, 1.85 Å

PDB Description: Crystal structure of ubch5c

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 D3

SCOP Domain Sequences for d1x23c1:

Sequence; same for both SEQRES and ATOM records:

>d1x23c1 d.20.1.1 (C:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 D3 [TaxId: 9606]}
malkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrdkynrisrewtqkyam

Timeline for d1x23c1:

• d1x23c1 is new in SCOP 1.73
  
• d1x23c1 appears in SCOP 1.75
  
• d1x23c1 appears in the current release, SCOPe 2.08, called d1x23c2