Lineage for d1x23c1 (1x23 C:1-147)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720015Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)
  7. 720042Species Human (Homo sapiens), E2 D3 [TaxId:9606] [143054] (2 PDB entries)
  8. 720045Domain d1x23c1: 1x23 C:1-147 [121617]
    automatically matched to 1X23 A:1-147

Details for d1x23c1

PDB Entry: 1x23 (more details), 1.85 Å

PDB Description: Crystal structure of ubch5c
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 D3

SCOP Domain Sequences for d1x23c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x23c1 d.20.1.1 (C:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 D3 [TaxId: 9606]}
malkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrdkynrisrewtqkyam

SCOP Domain Coordinates for d1x23c1:

Click to download the PDB-style file with coordinates for d1x23c1.
(The format of our PDB-style files is described here.)

Timeline for d1x23c1: