Lineage for d1x23c2 (1x23 C:1-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2939257Protein automated matches [190124] (13 species)
    not a true protein
  7. 2939272Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)
  8. 2939281Domain d1x23c2: 1x23 C:1-147 [121617]
    Other proteins in same PDB: d1x23a1, d1x23a2, d1x23b3, d1x23c3, d1x23d3
    automated match to d1ur6a_

Details for d1x23c2

PDB Entry: 1x23 (more details), 1.85 Å

PDB Description: Crystal structure of ubch5c
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d1x23c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x23c2 d.20.1.1 (C:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrdkynrisrewtqkyam

SCOPe Domain Coordinates for d1x23c2:

Click to download the PDB-style file with coordinates for d1x23c2.
(The format of our PDB-style files is described here.)

Timeline for d1x23c2: