Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) |
Family c.1.2.3: Decarboxylase [51375] (3 proteins) |
Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species) |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (18 PDB entries) |
Domain d1x1za1: 1x1z A:11-222 [121613] automatically matched to d1klya_ complexed with bmp, gol; mutant |
PDB Entry: 1x1z (more details), 1.45 Å
SCOP Domain Sequences for d1x1za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1za1 c.1.2.3 (A:11-222) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg etlrfadaiivgrsiyladnpaaaaagiiesi
Timeline for d1x1za1: