Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) |
Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins) |
Protein Barnase [81305] (1 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (43 PDB entries) |
Domain d1x1xc1: 1x1x C:2-110 [121609] Other proteins in same PDB: d1x1xd1, d1x1xe1, d1x1xf1 automatically matched to d1b27a_ mutant |
PDB Entry: 1x1x (more details), 2.3 Å
SCOP Domain Sequences for d1x1xc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1xc1 d.1.1.2 (C:2-110) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]} qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
Timeline for d1x1xc1: