SCOP 1.75: Domain d1x1xc1: 1x1x C:2-110

Lineage for d1x1xc1 (1x1x C:2-110)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (43 PDB entries)

8. Domain d1x1xc1: 1x1x C:2-110 [121609]
   Other proteins in same PDB: d1x1xd1, d1x1xe1, d1x1xf1
   automatically matched to d1b27a_
   mutant

Details for d1x1xc1

PDB Entry: 1x1x, 2.3 Å

PDB Description: water-mediate interaction at aprotein-protein interface

PDB Compounds: (C:) Ribonuclease

SCOP Domain Sequences for d1x1xc1:

Sequence; same for both SEQRES and ATOM records:

>d1x1xc1 d.1.1.2 (C:2-110) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d1x1xc1:

• d1x1xc1 first appeared in SCOP 1.73
  
• d1x1xc1 is called d1x1xc_ in SCOPe 2.01
  
• d1x1xc1 appears in the current release, SCOPe 2.08, called d1x1xc_