| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
| Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
| Protein Barnase [81305] (1 species) |
| Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries) |
| Domain d1x1wc_: 1x1w C: [121606] Other proteins in same PDB: d1x1wd1, d1x1we_, d1x1wf_ automated match to d1b27a_ |
PDB Entry: 1x1w (more details), 2.1 Å
SCOPe Domain Sequences for d1x1wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1wc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
Timeline for d1x1wc_: