![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
![]() | Superfamily c.9.1: Barstar-related [52038] (1 family) ![]() |
![]() | Family c.9.1.1: Barstar-related [52039] (2 proteins) |
![]() | Protein Barstar (barnase inhibitor) [52040] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (12 PDB entries) |
![]() | Domain d1x1uf1: 1x1u F:1-89 [121603] Other proteins in same PDB: d1x1ua1, d1x1ub1, d1x1uc1 automatically matched to d1b27d_ mutant |
PDB Entry: 1x1u (more details), 2.3 Å
SCOP Domain Sequences for d1x1uf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1uf1 c.9.1.1 (F:1-89) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]} kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqsk qltengaesvlqvfreakaegaditiils
Timeline for d1x1uf1: