Lineage for d1x1uc_ (1x1u C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2530966Protein Barnase [81305] (1 species)
  7. 2530967Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 2531035Domain d1x1uc_: 1x1u C: [121600]
    Other proteins in same PDB: d1x1ud_, d1x1ue_, d1x1uf_
    automated match to d1b27a_

Details for d1x1uc_

PDB Entry: 1x1u (more details), 2.3 Å

PDB Description: water-mediate interaction at aprotein-protein interface
PDB Compounds: (C:) Ribonuclease

SCOPe Domain Sequences for d1x1uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1uc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOPe Domain Coordinates for d1x1uc_:

Click to download the PDB-style file with coordinates for d1x1uc_.
(The format of our PDB-style files is described here.)

Timeline for d1x1uc_: