SCOP 1.73: Domain d1x1uc1: 1x1u C:2-110

Lineage for d1x1uc1 (1x1u C:2-110)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (43 PDB entries)

8. Domain d1x1uc1: 1x1u C:2-110 [121600]
   Other proteins in same PDB: d1x1ud1, d1x1ue1, d1x1uf1
   automatically matched to d1b27a_
   mutant

Details for d1x1uc1

PDB Entry: 1x1u, 2.3 Å

PDB Description: water-mediate interaction at aprotein-protein interface

PDB Compounds: (C:) Ribonuclease

SCOP Domain Sequences for d1x1uc1:

Sequence; same for both SEQRES and ATOM records:

>d1x1uc1 d.1.1.2 (C:2-110) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d1x1uc1:

• d1x1uc1 is new in SCOP 1.73
  
• d1x1uc1 appears in SCOP 1.75
  
• d1x1uc1 appears in the current release, SCOPe 2.08, called d1x1uc_