![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) ![]() |
![]() | Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins) |
![]() | Protein Barnase [81305] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (43 PDB entries) |
![]() | Domain d1x1uc1: 1x1u C:2-110 [121600] Other proteins in same PDB: d1x1ud1, d1x1ue1, d1x1uf1 automatically matched to d1b27a_ mutant |
PDB Entry: 1x1u (more details), 2.3 Å
SCOP Domain Sequences for d1x1uc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1uc1 d.1.1.2 (C:2-110) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]} qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
Timeline for d1x1uc1: