SCOP 1.73: Domain d1x1sa1: 1x1s A:11-178

Lineage for d1x1sa1 (1x1s A:11-178)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein M-Ras (XRas) [142283] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142284] (2 PDB entries)

8. Domain d1x1sa1: 1x1s A:11-178 [121596]
   automatically matched to 1X1R A:10-178
   complexed with gnp, mg

Details for d1x1sa1

PDB Entry: 1x1s, 2.2 Å

PDB Description: Crystal structure of M-Ras in complex with GppNHp

PDB Compounds: (A:) Ras-related protein M-Ras

SCOP Domain Sequences for d1x1sa1:

Sequence, based on SEQRES records:

>d1x1sa1 c.37.1.8 (A:11-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}
lptyklvvvgdggvgksaltiqffqkifvpdydptiedsylkhteidnqwaildvldtag
qeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdl
mhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq

Sequence, based on observed residues (ATOM records):

>d1x1sa1 c.37.1.8 (A:11-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}
lptyklvvvgdggvgksaltiqffqkifvpdydptiedsylkhteidnqwaildvldtfs
amreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdlmhlrk
vtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq

Timeline for d1x1sa1:

• d1x1sa1 is new in SCOP 1.73
  
• d1x1sa1 appears in SCOP 1.75
  
• d1x1sa1 appears in the current release, SCOPe 2.08, called d1x1sa_