Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186847] (24 PDB entries) |
Domain d1x1sa_: 1x1s A: [121596] automated match to d1agp__ complexed with gnp, mg |
PDB Entry: 1x1s (more details), 2.2 Å
SCOPe Domain Sequences for d1x1sa_:
Sequence, based on SEQRES records: (download)
>d1x1sa_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lptyklvvvgdggvgksaltiqffqkifvpdydptiedsylkhteidnqwaildvldtag qeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdl mhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq
>d1x1sa_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lptyklvvvgdggvgksaltiqffqkifvpdydptiedsylkhteidnqwaildvldtfs amreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdlmhlrk vtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq
Timeline for d1x1sa_: