Lineage for d1x1ra1 (1x1r A:10-178)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846765Protein Ras-related protein M-Ras (XRas) [142283] (1 species)
  7. 1846766Species Mouse (Mus musculus) [TaxId:10090] [142284] (1 PDB entry)
    Uniprot O08989 10-178
  8. 1846767Domain d1x1ra1: 1x1r A:10-178 [121595]
    complexed with gdp, mg

Details for d1x1ra1

PDB Entry: 1x1r (more details), 1.3 Å

PDB Description: Crystal structure of M-Ras in complex with GDP
PDB Compounds: (A:) Ras-related protein M-Ras

SCOPe Domain Sequences for d1x1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}
nlptyklvvvgdggvgksaltiqffqkifvpdydptiedsylkhteidnqwaildvldta
gqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvd
lmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq

SCOPe Domain Coordinates for d1x1ra1:

Click to download the PDB-style file with coordinates for d1x1ra1.
(The format of our PDB-style files is described here.)

Timeline for d1x1ra1: