| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Ras-related protein M-Ras (XRas) [142283] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [142284] (1 PDB entry) Uniprot O08989 10-178 |
| Domain d1x1ra1: 1x1r A:10-178 [121595] complexed with gdp, mg |
PDB Entry: 1x1r (more details), 1.3 Å
SCOPe Domain Sequences for d1x1ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}
nlptyklvvvgdggvgksaltiqffqkifvpdydptiedsylkhteidnqwaildvldta
gqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvd
lmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq
Timeline for d1x1ra1: