Lineage for d1x1pa1 (1x1p A:1-196)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 836758Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 836776Protein Class II ribonuclease H (RNase HII) [53103] (5 species)
  7. 836783Species Archaeon Pyrococcus horikoshii [TaxId:53953] [110639] (2 PDB entries)
    Uniprot O59351
  8. 836786Domain d1x1pa1: 1x1p A:1-196 [121594]
    automatically matched to d1uaxa_

Details for d1x1pa1

PDB Entry: 1x1p (more details), 2.8 Å

PDB Description: Crystal structure of Tk-RNase HII(1-197)-A(28-42)
PDB Compounds: (A:) ribonuclease hii

SCOP Domain Sequences for d1x1pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1pa1 c.55.3.1 (A:1-196) Class II ribonuclease H (RNase HII) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
enyyrehgefppivrk

SCOP Domain Coordinates for d1x1pa1:

Click to download the PDB-style file with coordinates for d1x1pa1.
(The format of our PDB-style files is described here.)

Timeline for d1x1pa1: