SCOPe 2.08: Domain d1x1pa1: 1x1p A:1-196

Lineage for d1x1pa1 (1x1p A:1-196)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein Class II ribonuclease H (RNase HII) [53103] (5 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [110639] (2 PDB entries)
   Uniprot O59351

8. Domain d1x1pa1: 1x1p A:1-196 [121594]
   Other proteins in same PDB: d1x1pa2
   automatically matched to d1uaxa_
   has additional insertions and/or extensions that are not grouped together

Details for d1x1pa1

PDB Entry: 1x1p, 2.8 Å

PDB Description: Crystal structure of Tk-RNase HII(1-197)-A(28-42)

PDB Compounds: (A:) ribonuclease hii

SCOPe Domain Sequences for d1x1pa1:

Sequence; same for both SEQRES and ATOM records:

>d1x1pa1 c.55.3.1 (A:1-196) Class II ribonuclease H (RNase HII) {Pyrococcus horikoshii [TaxId: 53953]}
mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
enyyrehgefppivrk

Timeline for d1x1pa1:

• d1x1pa1 first appeared in SCOP 1.73
  
• d1x1pa1 appears in SCOPe 2.07