![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
![]() | Protein Class II ribonuclease H (RNase HII) [53103] (5 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [110639] (2 PDB entries) Uniprot O59351 |
![]() | Domain d1x1pa1: 1x1p A:1-196 [121594] Other proteins in same PDB: d1x1pa2 automatically matched to d1uaxa_ has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1x1p (more details), 2.8 Å
SCOPe Domain Sequences for d1x1pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1pa1 c.55.3.1 (A:1-196) Class II ribonuclease H (RNase HII) {Pyrococcus horikoshii [TaxId: 53953]} mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl enyyrehgefppivrk
Timeline for d1x1pa1: