Lineage for d1x1ma1 (1x1m A:8-101)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1017617Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1018017Protein Ubiquitin-like protein 7 [142942] (1 species)
  7. 1018018Species Mouse (Mus musculus) [TaxId:10090] [142943] (1 PDB entry)
    Uniprot Q91W67 1-94
  8. 1018019Domain d1x1ma1: 1x1m A:8-101 [121592]

Details for d1x1ma1

PDB Entry: 1x1m (more details)

PDB Description: solution structure of the n-terminal ubiquitin-like domain in mouse ubiquitin-like protein sb132
PDB Compounds: (A:) Ubiquitin-like protein SB132

SCOPe Domain Sequences for d1x1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]}
mslsdwhlavkladqplapksilqlpetelgeyslggysisflkqliagklqesvpdpel
idliycgrklkddqtldfygiqpgstvhvlrksw

SCOPe Domain Coordinates for d1x1ma1:

Click to download the PDB-style file with coordinates for d1x1ma1.
(The format of our PDB-style files is described here.)

Timeline for d1x1ma1: