Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein GTPase Era C-terminal domain [54818] (3 species) |
Species Escherichia coli [TaxId:562] [54819] (2 PDB entries) |
Domain d1x1lx2: 1x1l X:183-295 [121591] Other proteins in same PDB: d1x1lx1 automatically matched to d1egab2 protein/RNA complex |
PDB Entry: 1x1l (more details), 13.5 Å
SCOPe Domain Sequences for d1x1lx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1lx2 d.52.3.1 (X:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl
Timeline for d1x1lx2: