Lineage for d1x1lx2 (1x1l X:183-295)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722707Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 722734Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 722735Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 722736Protein GTPase Era C-terminal domain [54818] (2 species)
  7. 722737Species Escherichia coli [TaxId:562] [54819] (3 PDB entries)
  8. 722741Domain d1x1lx2: 1x1l X:183-295 [121591]
    Other proteins in same PDB: d1x1lx1
    automatically matched to d1egab2

Details for d1x1lx2

PDB Entry: 1x1l (more details)

PDB Description: interaction of era,a gtpase protein, with the 3'minor domain of the 16s rrna within the thermus thermophilus 30s subunit.
PDB Compounds: (X:) GTP-binding protein era

SCOP Domain Sequences for d1x1lx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1lx2 d.52.3.1 (X:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]}
dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq
kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl

SCOP Domain Coordinates for d1x1lx2:

Click to download the PDB-style file with coordinates for d1x1lx2.
(The format of our PDB-style files is described here.)

Timeline for d1x1lx2: