SCOPe 2.08: Domain d1x1lx2: 1x1l X:183-295

Lineage for d1x1lx2 (1x1l X:183-295)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein GTPase Era C-terminal domain [54818] (3 species)

7. Species Escherichia coli [TaxId:562] [54819] (2 PDB entries)

8. Domain d1x1lx2: 1x1l X:183-295 [121591]
   Other proteins in same PDB: d1x1lx1
   automatically matched to d1egab2
   protein/RNA complex

Details for d1x1lx2

PDB Entry: 1x1l

PDB Description: interaction of era,a gtpase protein, with the 3'minor domain of the 16s rrna within the thermus thermophilus 30s subunit.

PDB Compounds: (X:) GTP-binding protein era

SCOPe Domain Sequences for d1x1lx2:

Sequence; same for both SEQRES and ATOM records:

>d1x1lx2 d.52.3.1 (X:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]}
dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq
kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl

Timeline for d1x1lx2:

• d1x1lx2 first appeared in SCOP 1.73
  
• d1x1lx2 appears in SCOPe 2.07