Lineage for d1x1lx1 (1x1l X:4-182)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846354Protein GTPase Era, N-terminal domain [52637] (3 species)
  7. 1846358Species Escherichia coli [TaxId:562] [52638] (2 PDB entries)
  8. 1846361Domain d1x1lx1: 1x1l X:4-182 [121590]
    Other proteins in same PDB: d1x1lx2
    automatically matched to d1egaa1
    protein/RNA complex

Details for d1x1lx1

PDB Entry: 1x1l (more details), 13.5 Å

PDB Description: interaction of era,a gtpase protein, with the 3'minor domain of the 16s rrna within the thermus thermophilus 30s subunit.
PDB Compounds: (X:) GTP-binding protein era

SCOPe Domain Sequences for d1x1lx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1lx1 c.37.1.8 (X:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}
dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe

SCOPe Domain Coordinates for d1x1lx1:

Click to download the PDB-style file with coordinates for d1x1lx1.
(The format of our PDB-style files is described here.)

Timeline for d1x1lx1: