SCOPe 2.01: Domain d1x1lx1: 1x1l X:4-182

Lineage for d1x1lx1 (1x1l X:4-182)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTPase Era, N-terminal domain [52637] (2 species)

7. Species Escherichia coli [TaxId:562] [52638] (3 PDB entries)

8. Domain d1x1lx1: 1x1l X:4-182 [121590]
   Other proteins in same PDB: d1x1lx2
   automatically matched to d1egaa1
   protein/RNA complex

Details for d1x1lx1

PDB Entry: 1x1l, 13.5 Å

PDB Description: interaction of era,a gtpase protein, with the 3'minor domain of the 16s rrna within the thermus thermophilus 30s subunit.

PDB Compounds: (X:) GTP-binding protein era

SCOPe Domain Sequences for d1x1lx1:

Sequence; same for both SEQRES and ATOM records:

>d1x1lx1 c.37.1.8 (X:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}
dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe

Timeline for d1x1lx1:

• d1x1lx1 first appeared in SCOP 1.73
  
• d1x1lx1 appears in SCOP 1.75
  
• d1x1lx1 appears in SCOPe 2.02
  
• d1x1lx1 appears in the current release, SCOPe 2.08